PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA04G20570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 363aa    MW: 35957.8 Da    PI: 8.6707
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA04G20570.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.2e-3959120263
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                      kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  ONIVA04G20570.1  59 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 120
                      7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3155117IPR003851Zinc finger, Dof-type
PfamPF027012.4E-3361117IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05963117IPR003851Zinc finger, Dof-type
PROSITE patternPS01361065101IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MEEMLMAANA AAGANPNPAA TAPSSVTGGA LRGGGGGGAP PVAGGAGAGS TERRARPQKE  60
KALNCPRCNS TNTKFCYYNN YSLQQPRYFC KTCRRYWTEG GSLRNVPVGG GSRKNKRSSS  120
SAASASPASA STANSVVTSA SMSMSMASTG GGASKNPKLV HEGAQDLNLA FPHHGGLQAP  180
GEFPAFPSLE SSSVCNPGGP MGTNGRGGGA LSAMELLRST GCYMPLQVPM QMPAEYATPG  240
FALGEFRAPP PPPQSSQSLL GFSLDAHGSV GGPSAAGFGS SAGLQGVPES TGRLLFPFED  300
LKPTVSSGTG GGGASGGGAG VDGGHQFDHG KEQQAGGGGG GPGGHDTPGF WNGMIGGGSG  360
TSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126120.0CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8551490.0CR855149.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0103M18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637009.10.0PREDICTED: dof zinc finger protein DOF4.6 isoform X2
TrEMBLA0A0E0H4I60.0A0A0E0H4I6_ORYNI; Uncharacterized protein
TrEMBLA0A0P0WDP60.0A0A0P0WDP6_ORYSJ; Os04g0567800 protein
STRINGLOC_Os04g47990.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA014530-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-42Dof family protein